PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539974.1_FGP003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 171aa    MW: 19256.7 Da    PI: 4.9324
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539974.1_FGP003genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS132.35.3e-4119168159311
               GRAS 159 eetgerLakfAeelgv.pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhn 249
                        ++ g+ L+ +Ae lg+  +ef++ v ++le+l++e+L ++ +Ea+a+n+vl+lh +++es    +   +vL++++ lsP+ +v+veq+a hn
  KN539974.1_FGP003  19 RASGRELEAYAEGLGMmYLEFRT-VDRSLESLHIEDLGIDADEAVAINSVLELHPVVKESRGALN---SVLQTIRILSPRAFVLVEQDAGHN 106
                        677999********97269****.799******************************88877777...8*********************** PP

               GRAS 250 sesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhet 311
                        ++ Fl rf+eal+yy++lfd+l+a++pr +  r+ vE++ +g ei+nvv  ega+r+erhe 
  KN539974.1_FGP003 107 GPFFLGRFMEALQYYATLFDALDAEIPRYDARRARVEQFHFGTEIRNVVGWEGAARVERHEC 168
                        ************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098525.6291171IPR005202Transcription factor GRAS
PfamPF035141.8E-3819168IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MGLDRGHRWR GLLDGLAARA SGRELEAYAE GLGMMYLEFR TVDRSLESLH IEDLGIDADE  60
AVAINSVLEL HPVVKESRGA LNSVLQTIRI LSPRAFVLVE QDAGHNGPFF LGRFMEALQY  120
YATLFDALDA EIPRYDARRA RVEQFHFGTE IRNVVGWEGA ARVERHECAD Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-191165116307GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0037910.0AP003791.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1065G12.
GenBankAP0067570.0AP006757.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0551C06.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456800.12e-91hypothetical protein SORBIDRAFT_03g043030
RefseqXP_004970957.12e-91PREDICTED: DELLA protein RGL1-like
TrEMBLA0A0D3EXI71e-115A0A0D3EXI7_9ORYZ; Uncharacterized protein
STRINGORGLA01G0348000.18e-95(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56403354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.16e-26RGA-like 1